Expériences pour l'étude de la structure primaire de l'hirudine
Flux RSS

 

L'hirudine, protéine extraite des glandes salivaires de sangsue (anglais : "leech" - Hirudo medicinalis), inhibe l'action de la thrombine dans la coagulation du sang (conversion du fibrinogène en fibrine).

L'effet inhibiteur est dû à une liaison spécifique de l'hirudine à la thrombine qui entraîne une inactivation irréversible de l'enzyme.

  • Chang, J. Y. (1983) "The functional domain of hirudin, a thrombin-specific inhibitor" FEBS Lett. 164, 307 - 313
  • Dodt et al. (1984) "The complete amino acid sequence of hirudin, a thrombin specific inhibitor : Application of colour carboxymethylation" FEBS Letters 165, 180 - 184

Retour haut de page

La composition en acide aminés de l'hirudine (65 acides aminés) purifiée révèle des acides aminés particulier :

La digestion de l'hirudine native par une aminopeptidase (EC 3.4.11.2) ne libère aucun acide aminé.

La digestion de l'hirudine préalablement réduite et carboxyméthylée par la même enzyme permet la libération d'une valine.

Reduction pont disulfure mercaptoethanol Structure proteine protease inhibition sequence acide amine thrombine hirudine biochimej

Quelles conclusions peut-on tirer ?

1. L'hirudine est une protéine trés acide comme l'indique la composition en acide aminé et le point isoélectrique.

2. Le fait qu'aucun acide aminé ne soit libéré après hydrolyse par l'aminopeptidase souligne un encombrement stérique autour de l'acide aminé N-terminal.

Cet encombrement stérique peut-être dû à une conformation "globulaire" stabilisée un pont disulfure. On peut donc supposer qu'une cystéine se trouve proche de l'extrémité N-terminale dans la séquence en acides aminés.

Visualisation de l'hirudine de Hirudo medicinalis obtenue par résonance magnétique nucléaire

Code PDB : 5HIR

Les ponts disulfure apparaissent en jaune.

Remarques :

  • mutant Lys 47
  • les acides aminés Ser 50 à Gln 65 n'ont pas été résolus et n'apparaissent pas dans cette structure

Retour haut de page

Cinétique de libération des PTH - acides aminés en position C-terminale

La séquence C-terminale de l'hirudine est obtenue par action de la carboxypeptidase Y :

  • on prélève une fraction aliquote du milieu réactionnel à différents temps d'action de l'enzyme.
  • l'échantillon est traité par l'isothiocyanate de phényle (PITC).
  • on sépare le phénylthiohydantoïne acide aminé (PTH - acide aminé) libéré par l'action de l'enzyme par chromatographie en phase reverse.
  • on enregistre la cinétique de libération des acides aminés (figure ci-dessous).

Cinetique liberation PITC PTH acide amine structure proteine protease inhibition sequence acide amine thrombine hirudine biochimej

Une cinétique de libération identique est obtenue à partir de l'hirudine préalablement réduite et carboxyméthylée.

Quelles conclusions peut-on tirer ?

La carboxypeptidase Y (EC 3.4.17.1) :

  • a environ la même spécificité pour tous les acides aminés.
  • arrête d'hydrolyser la chaîne polypeptidique si l'avant dernier acide aminé est Gly.
  • le clivage de Asp et Glu est lent.

L'extrémité C-terminale de l'hirudine n'est donc pas bloquée par encombrement stérique puisque la carboxypeptidase Y peut agir.

La séquence C-terminale de l'hirudine est : - X - Glu61 - Glu62 - Tyr63 - Leu64 - Gln65 - COOH

Retour haut de page

Marquage radioactif

La séquence partielle de l'hirudine réduite et traitée à l'iodoacétamide radioactif a été déterminée par la méthode d'Edman. Les résultats correspondants aux résidus radioactifs sont présentés dans la figure ci-dessous.

Marquage radioactif cysteine degradation Edman structure proteine protease inhibition sequence acide amine thrombine hirudine biochimej

La séquence N-terminale complète est : NH2 - V - V - Y - T - D - C6 - T - E - S -G - Q - N - L

Quelles conclusions peut-on tirer ?

Les cystéines sont marquées par l'iodoacétamide.

Marquage cysteine iodoacetamide structure proteine protease inhibition sequence acide amine thrombine hirudine biochimej

L'iodoacétamide et l'iodoacétate sont des réactifs des groupements thiols (-SH) :

  • l'iodoacétamide ne change pas la charge
  • l'iodoacétate introduit une charge négative par -SH dérivé

Les cycles où la radioactivité est détectée indiquent la position des Cys dans la séquences de l'hirudine. Celle-ci contient donc 6 Cys aux positions : 6, 14, 16, 22, 28 et 39.

Remarque : la décroissance de la quantité de radioactivité détectée en fonction du nombre de cycle est dûe à la dénaturation des chaînes polypeptidiques à chaque cycle de dégradation (alternance de solution acide et basique, action du PITC, ...).

Il y a donc de moins en moins de chaînes polypeptidiques susceptibles d'être traitées, donc de moins en moins de cystéine libérée.

Retour haut de page

Séparation des produits de digestion de l'hirudine par chromatographie de filtration sur gel.

(voir le domaine de fractionnement de ce type de gel)

L'hirudine a été digérée par la protéase V8 (EC 3.4.21.19) qui hydrolyse spécifiquement la liaison peptidique du côté carboxyle des acides aminés Glu & Asp. Dans certaines conditions, la coupure se fait exclusivement après Glu.

Parmi les produits de digestions majeurs, deux ont été détectés après séparation par chromatographie de filtration sur gel.

masse molaire chromatographie filtration gel Structure proteine protease inhibition sequence acide amine thrombine hirudine biochimej

  • Calculez la masse molaire de chacun des fragments.
  • La protéine est constituée de 65 acides aminés. Si l'on considère une masse molaire moyenne de 140 Da pour chaque acide aminé, à quelle position dans la séquence primaire se situe le site de digestion ?

Quand la liaison peptidique est formée, il y a élimination d'une molécule d'eau (18 Da). La masse molaire d'un résidu d'acide aminé est donc, en moyenne : MM = 140 Da - 18 Da = 122 Da.

65 acides aminés correspondent à une masse molaire pour l'hirudine d'environ 7930 Da. D'après la droite d'élution on détermine :

  • Fragment 1 : masse molaire = 5490 Da ==> soit un fragment d'environ : (5490 / 122) = 45 acides aminés
  • Fragment 2 : masse molaire = 2440 Da ==> soit un fragment d'environ : (2440 / 122) = 20 acides aminés

On peut supposer que la protéase V8 coupe la liaison (voir séquence ci-dessous) : Val1 ------ Glu43 / Gly44 ------ Gln65

Retour haut de page

Digestion par la trypsine

Un peptide isolé après digestion partielle de l'hirudine (préalablement réduite) par la trypsine a la composition en acides aminés suivante : 2N, 3Q, 1C, 1V, 2T, 3G, 5E, 3P, 1K, 1S, 1H, 2D, 1F, 1I, 1Y, 1L.
La Tyr est sulfatée.

De quel fragment s'agit-il ?

La trypsine (EC 3.4.21.4) coupe la liaison peptidique après Arg et Lys. Comme l'hirudine ne contient que 3 Lys (et pas d'Arg), il n'y a que 3 sites de coupures potentiels.

La digestion est partielle, il n'y a donc que 1 ou 2 coupures. En conséquence, 2 ou 3 fragments sont générés après hydrolyse.

hydrolyse trypsine protease structure proteine protease inhibition sequence acide amine thrombine hirudine biochimej

  • La Tyr est sulfatée (Tyr63). C'est donc un peptide du côté C-terminal.
  • Ce peptide ne contient qu'une seule Cys : celle-ci ne peut-être que la Cys39.
  • L'avant-dernière Cys étant en position 28, il faudrait une Lys en position 29. Le peptide ne peut commencer qu'en position 30.
  • Le peptide isolé fait 29 acides aminés. C'est donc l'un des suivants : [30--> 58] ou [31--> 59] ou [32--> 60] ou ... [37--> 65].
  • Le peptide isolé contient une Lys. Ce site n'a donc pas été coupé par la trypsine.
  • Le peptide isolé contient la Tyr sulfatée (Tyr63) et il n'y a pas de Lys après cette Tyr.

En conséquence il s'agit du fragment [37--> 65].

Retour haut de page

Hirudine Inhibition de
la thrombine
Interprétation
native 100 % Témoin positif
réduite 10 % Sans pont disulfure, l'hirudine perd sa structure native (mais n'est pas dénaturée).
Les 10 % d'activité résiduelle sont dûs aux molécules non réduites.
désulfatée à 60% 87 % La Tyr63 est de plus en plus désulfatée.
Indique l'importance d'au moins une charge négative du côté C-terminal pour l'interaction avec la thrombine.
désulfatée à 100% 45 %
réduite
protéase V8
3 % L'hirudine est sous la forme de 2 fragments (1
Souligne que l'interaction avec la thrombine se fait du côté C-terminal mais aussi du côté N-terminal.
native
carboxypeptidase Y - 20 min
8 % L'hirudine n'a plus l'extrémité C-terminale : -E62-Y63-L64-Q65-COO-
Ce résultat souligne l'importance d'un ensemble de charges négatives à l'extrémité C-terminale pour les interactions avec la thrombine.
après estérification
des COOH
0 % Toutes les charges négatives ont disparu (formation d'ester). Ce résultat confirme le résultat ci-dessus.
Réaction d'estérification : R- COO- + R'-OH ---> R-CO-O-R' + H2O

Séquence en acide aminés de l'hirudine de sangsue (Hirudo medicinalis) - 65 acides aminés - La tyrosine 63 est sulfatée.

>gi|231142|pdb|5HIR| Hirudin (Wild-Type)
V1VYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEY63LQ65

Retour haut de page

Valid XHTML 1.0 Transitional