Etude de l'adrénocorticotropine
Flux RSS


L'adrénocorticotropine (ACTH) est une hormone antéhypophysaire régulant la production de cortisol par les glandes surrénales.

L'ACTH est un peptide composé de 39 acides aminés dont la séquence est : SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

(ou : Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Gln-Ala-Phe-Pro-Leu-Glu-Phe).

1. On traite l'ACTH par la trypsine : combien de peptides obtient-on ? Quel est l'ordre de migration dans un gradient de pH ?

2. L'ACTH est marquée par l'iode radioactif (NaI125) en présence de lactoperoxydase et de H2O2. On dépose le mélange sur un gel Séphadex G25 dont le domaine d'exclusion est de 5000. L'immunoréactivité de chaque fraction est mesurée avec des anticorps anti-ACTH.

Le profil d'élution est présenté dans la figure ci-dessous.

Immunoreactivite adrenocorticotropine trypsine iodination peptide immunoreactivite HPLC biochimej

  • Expliquer l'expérience.
  • Que représentent les pics A et B ?

3. Le produit A est traité par la trypsine puis analysé par chromatographie liquide à haute performance sur une phase réverse en C18. Les peptides sont élués par un gradient [propanol : eau] (figure ci-dessous).

radioactivite adrenocorticotropine trypsine iodination peptide immunoreactivite HPLC biochimej

Après séparation, les peptides radioactifs C et D sont analysés par isofocalisation, avant ou après traitement par la carboxypeptidase B, sur un gel de polyacrylamide avec un gradient de pH de 2 à 8, suivie d'une autoradiographie. Les résultats sont présentés dans la figure ci-dessous.

isofocalisation radioactivite adrenocorticotropine trypsine iodination peptide immunoreactivite HPLC biochimej

  • Pistes 1 : peptide trypsique isolé C ou D
  • Pistes 2 : peptide trypsique isolé C ou D après traitement par la carboxypeptidase B

a. Quel peptide est déposé sur le gel de gauche et sur le gel de droite, respectivement ?

b. Rappeler le mode d'action de la carboxypeptidase B.

Retour haut de page

Voir la pro-opiomélanocortine : molécule protéique précurseur de l'ACTH et d'une dizaine d'autres hormones polypeptidiquestelles que la (met-enképhaline, la β-endorphine, la β-lipotropine, ...).

1. La trypsine (EC coupe la liaison peptidique après Arg et Lys sauf si ces acides aminés sont suivis par Pro.

Cependant elle peut avoir une spécificité plus complexe.

hydrolyse peptide trypsine radioactivite adrenocorticotropine trypsine iodination HPLC biochimej

Le traitement de l'ACTH par la trypsine donne donc : 4 peptides (1 à 4) et 2 acides aminés (Lys16 et Arg17).

Retour haut de page

Ordre de migration dans un gradient de pH

Calcul du pI du peptide 1 : NH3+-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-COO-

Groupement ionisable deprotonable peptide pK ionization titration adrenocorticotropine iodination peptide immunoreactivite HPLC biochimej

groupe pKa pH < pKa (αCOOH) - 2 pH > pKa (αCOOH) + 2 pH > pKa (γCOOH) + 2 pH > pKa (-NH+) + 2 pH > pKa (αNH3+) + 2 pH > pKa (-OH) + 2 pH > pKa (=NH2+) + 2
-NH+ 6 -NH+ -NH+ -NH+ -N: -N: -N: -N:
αNH3+ 9,2 αNH3+ αNH3+ αNH3+ αNH3+ αNH2 αNH2 αNH2
-OH 10,1 -OH -OH -OH -OH -OH -O- -O-
=NH2+ 12,5 =NH2+ =NH2+ =NH2+ =NH2+ =NH2+ =NH2+ =NH
Charge 3 + 2 + 1 + 0 (zwitterion) 1 - 2 - 3 -

Calcul du pI du peptide 1 avec la formule la plus simple autour du zwitterion : pI = 1/2 [pKa His + pKa αNH3+] ≈ 7,6

Peptide Charges pI Migration
peptide 1 : NH3+-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-COO- +3 à -3 1/2 [pKa His + pKa αNH3+] ≈ 7,6

electrophorese hydrolyse peptide trypsine radioactivite adrenocorticotropine trypsine iodination HPLC biochimej

peptide 2 : NH3+-Trp-Gly-Lys-Pro-Val-Gly-Lys-COO-

+3 à -1

Attention : 2 Lys donc charge initiale = +3

1/2 [pKa Lys + pKa Lys] ≈ 10,5
peptide 3 : NH3+-Arg-Pro-Val-Lys-COO- +3 à -0,8 (pH 13) 1/2 [pKa Lys + pKa Arg] ≈ 11,5
peptide 4 : NH3+-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Gln-Ala-Phe-Pro-Leu-Glu-Phe-COO- +1 à -6 1/2 [pKa αCOOH + pKa Asp (βCOOH)] ≈ 2,85

Applications de calcul de pI en ligne :

Les valeurs sont parfois assez différentes d'un prédicteur à l'autre.

Voir un développement sur les gels bidimensionnels : gel d'isoélectrofocalisation (IEF) et gel d'électrophorèse de polyacrylamide en conditions dénaturantes.

Retour haut de page

2. Les fractions d'élution du pic A porte à la fois la radioactivité et l'immunoréactivité.

radioactivite immunoreactivite radioactivite adrenocorticotropine trypsine iodination HPLC biochimej

Par ailleurs la masse molaire de l'ACTH = 4541 Daltons, valeur qui est de l'ordre de la limite d'exclusion du gel Séphadex G25.

Donc :

  • pic A ==> ACTH marquée
  • pic B ==> NaI125 en excès (masse molaire NaI = 150)

En présence de peroxydase, d'H2O2 et de tyrosine, les ions iodure sont transformés en iode positif (I+) qui substituent les hydrogènes en position ortho du noyau aromatique de la tyrosine (figure ci-dessous).

lactoperoxydase iodation tyrosine radioactivite adrenocorticotropine trypsine iodination biochimej

  • La réaction peut aussi avoir lieu sur l'histidine.
  • La lactoperoxydase (EC est présente dans la salive, dans les larmes et dans le lait.

En conséquence, les peptides issus de la digestion trypsique et qui contiennent une ou plusieurs Tyr sont radioactifs.

Il s'agit de :

  • peptide 1 : NH3+-Ser-Tyr*-Ser-Met-Glu-His-Phe-Arg-COO-
  • peptide 4 : NH3+-Val-Tyr*-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Gln-Ala-Phe-Pro-Leu-Glu-Phe-COO-

Retour haut de page

3. Par chromatographie en phase réverse, les peptides hydrophiles sont élués avant les peptides hydrophobes.

HPLC et radioactivite radioactivite immunoreactivite radioactivite adrenocorticotropine trypsine iodination HPLC biochimej

peptide % acides aminés hydrophiles Elution
peptide 1 6 / 8 = 75% élué en 1er ==> pic C
peptide 4 8 / 18 = 44% élué en 2ème ==> pic D

Les carboxypeptidases (EC font partie d'une trés grande famille d'hydrolases (peptidase M14). Elles hydrolysent les peptides intermédiaires qui résultent de la dégradation des protéines par les protéases digestives (pepsine, trypsine, chymotrypsine).

Elles sont sécrétées dans le suc pancréatique sous la forme de précurseurs inactifs appelés (zymogènes) : les pro-carboxypeptidases. Elles sont activées dans l'intestin par hydrolyse partielle par la trypsine.

La carboxypeptidase B hydrolyse préférentiellement les peptides qui ont un acide aminé à caractère basique (Arg, Lys) en position C-terminale.

Mais elle catalyse aussi d'autres réactions d'hydrolyse non spécifiques et des réactions de trans-estérification.

L'hydrolyse du peptide 1 par la carboxypeptidase B modifie le pI puisque c'est Arg qui est éliminé :
NH3+-Ser-Tyr*-Ser-Met-Glu-His-Phe-Arg-COO- ===> NH3+-Ser-Tyr*-Ser-Met-Glu-His-Phe-COO-

groupe pKa pH < pKa (αCOOH) - 2 pH > pKa (αCOOH) + 2 pH > pKa (γCOOH) + 2 pH > pKa (-NH+) + 2 pH > pKa (αNH3+) + 2 pH > pKa (-OH) + 2
-NH+ 6 -NH+ -NH+ -NH+ -N: -N: -N:
αNH3+ 9,2 αNH3+ αNH3+ αNH3+ αNH3+ αNH2 αNH2
-OH 10,1 -OH -OH -OH -OH -OH -O-
Charge 2 + 1 + 0 (zwitterion) 1 - 2 - 3 -
------------ pI = 1/2 [pKa γCOOH + pKa His + ] ≈ 5,15 -----------

En revanche, le pI du peptide 4 n'est pas modifié puisque la carboxypeptidase B ne l'hydrolyse pas (ou alors c'est Phe qui est éliminé).

  piste 1 piste 2
gel gauche = pic C peptide 1 : pI = 7,6 peptide 1 après carboxypeptidase B : pI = 5,15
gel droit = pic D peptide 4 : pI = 2,85 peptide 4 après carboxypeptidase B : pI = 2,85

  • Isofocalisation : migration jusqu'à une valeur de pH = pI du peptide.
  • Autoradiographie : révélation des bandes électrophorètiques par impression d'un film photographique par la radioactivité portée par la iodotyrosine.

isofocalisation radioactivite immunoreactivite radioactivite adrenocorticotropine trypsine iodination HPLC biochimej


Liens Internet et références bibliographiques
"Les propriétés acido-basiques des acides aminés" - Université Pierre et Marie Curie Aller au site
"Compute pI/MW" - Expasy Aller au site
Les ligands peptidiques radioactifs et fluorescents Aller au site
"The Titration Behavior of Amino Acids" Aller au site

Retour haut de page

Valid XHTML 1.0 Transitional